KCNAB2 Rabbit Polyclonal Antibody, Unconjugated

Catalog Number: BYT-ORB324736
Article Name: KCNAB2 Rabbit Polyclonal Antibody, Unconjugated
Biozol Catalog Number: BYT-ORB324736
Supplier Catalog Number: orb324736
Alternative Catalog Number: BYT-ORB324736-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human, Mouse
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human KCNAB2
Conjugation: Unconjugated
Alternative Names: anti AKR6A5 antibody, anti KCNA2B antibody, anti HKvbeta2 antibody, anti KV-BETA-2 antibody, anti HKvbeta2.1 antibody, anti HKvbeta2.2 antibody
Rabbit polyclonal antibody to KCNAB2
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 40kDa
NCBI: 003627
UniProt: Q13303
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: WGGKAETERGLSRKHIIEGLKASLERLQLEYVDVVFANRPDPNTPMEETV
Target: KCNAB2
Rabbit Anti-KCBAB2 Antibody, Paraffin Embedded Tissue: Human Kidney, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/mL, Magnification: 400X.
Sample Type: P48 Mouse, Dilution: 1:2000 tested with brain slices in Immunohistochemistry.
WB Suggested Anti-KCNAB2 Antibody, Titration: 1.25 ug/mL, Positive Control: Jurkat cell lysate.
WB Suggested Anti-KCNAB2 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: Jurkat cell lysate, KCNAB2 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells.
WB Suggested Anti-KCNAB2 antibody Titration: 1 ug/mL, Sample Type: Human HepG2.