SLCO3A1 Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB325106
- Images (5)
| Article Name: | SLCO3A1 Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: | BYT-ORB325106 |
| Supplier Catalog Number: | orb325106 |
| Alternative Catalog Number: | BYT-ORB325106-100 |
| Manufacturer: | Biorbyt |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | WB |
| Species Reactivity: | Human |
| Immunogen: | The immunogen is a synthetic peptide directed towards the middle region of human SLCO3A1 |
| Conjugation: | Unconjugated |
| Alternative Names: | anti FLJ40478 antibody, anti OATP-D antibody, anti OATP3A1 antibody, anti SLC21A11 antibody, anti OATPD antibody |
| Rabbit polyclonal antibody to SLCO3A1 |
| Clonality: | Polyclonal |
| Concentration: | 0.5 mg/ml |
| Molecular Weight: | 76kDa |
| NCBI: | 037404 |
| UniProt: | Q9UIG8 |
| Buffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: | Synthetic peptide located within the following region: MEIAVVAGFAAFLGKYLEQQFNLTTSSANQLLGMTAIPCACLGIFLGGLL |
| Target: | SLCO3A1 |
|
|
Sample Tissue: Human A172 Whole Cell, Antibody Dilution: 5 ug/mL. |
|
|
Sample Tissue: Human MCF7 Whole Cell, Antibody Dilution: 1 ug/mL. |
|
|
Sample Tissue: Human PANC1 Whole Cell, Antibody Dilution: 7 ug/mL. |
|
|
Sample Type: Human Fetal Lung, Antibody Dilution: 1.0 ug/mL. |
|
|
WB Suggested Anti-SLCO3A1 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: 721_B cell lysate. |
Product Guarantee and Expert Support
