TM6SF2 Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB325145
- Images (5)
| Article Name: | TM6SF2 Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: | BYT-ORB325145 |
| Supplier Catalog Number: | orb325145 |
| Alternative Catalog Number: | BYT-ORB325145-100 |
| Manufacturer: | Biorbyt |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | WB |
| Species Reactivity: | Human |
| Immunogen: | The immunogen is a synthetic peptide directed towards the C-terminal region of Human TM6SF2 |
| Conjugation: | Unconjugated |
| Rabbit polyclonal antibody to TM6SF2 |
| Clonality: | Polyclonal |
| Concentration: | 0.5 mg/ml |
| Molecular Weight: | 43 kDa |
| UniProt: | Q9BZW4 |
| Buffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: | Synthetic peptide located within the following region: FFTLFRGLVVLDCPTDACFVYIYQYEPYLRDPVAYPKVQMLMYMFYVLPF |
| Target: | TM6SF2 |
|
|
25 ug of the indicated Human whole cell extracts was loaded onto a 6-18% SDS-PAGE gel. 5 ug/mL of the antibody was used in this experiment. Several isoforms contain the peptide sequence including ~150 kDa and smaller isoforms from 23 to 53 kDa. |
|
|
Sample Tissue: Human Fetal Liver, Antibody Dilution: 1.0 ug/mL. |
|
|
Sample Type: 293T Whole cell lysates, Antibody Dilution: 1.0 ug/mL. |
|
|
Positive control (+): HepG2 (HG), Negative control (-): MCF7 (N10), Antibody concentration: 1 ug/mL. |
|
|
Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/mL in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown. |
Product Guarantee and Expert Support
