ND6 Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB325568
- Images (5)
| Article Name: | ND6 Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: | BYT-ORB325568 |
| Supplier Catalog Number: | orb325568 |
| Alternative Catalog Number: | BYT-ORB325568-100 |
| Manufacturer: | Biorbyt |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | WB |
| Species Reactivity: | Human |
| Immunogen: | The immunogen is a synthetic peptide directed towards the middle region of human ND6 |
| Conjugation: | Unconjugated |
| Alternative Names: | anti MTND6 antibody |
| Rabbit polyclonal antibody to ND6 |
| Clonality: | Polyclonal |
| Concentration: | 0.5 mg/ml |
| Molecular Weight: | 19kDa |
| NCBI: | 536854 |
| UniProt: | P03923 |
| Buffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: | Synthetic peptide located within the following region: DGVVVVVNFNSVGSWMIYEGEGSGLIREDPIGAGALYDYGRWLVVVTGWT |
| Target: | ND6 |
|
|
Sample Tissue: Human DLD1 Whole Cell, Antibody Dilution: 3 ug/mL. |
|
|
Sample Tissue: Human HT1080 Whole Cell, Antibody Dilution: 1 ug/mL. |
|
|
Sample Tissue: Human Lung Tumor, Antibody Dilution: 1 ug/mL. |
|
|
Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/mL in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown. |
|
|
WB Suggested Anti-ND6 Antibody Titration: 0.2-1 ug/mL, Positive Control: Human Lung. |
Product Guarantee and Expert Support
