KIAA1627 Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB325594
- Images (5)
| Article Name: | KIAA1627 Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: | BYT-ORB325594 |
| Supplier Catalog Number: | orb325594 |
| Alternative Catalog Number: | BYT-ORB325594-100 |
| Manufacturer: | Biorbyt |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | WB |
| Species Reactivity: | Human |
| Immunogen: | The immunogen is a synthetic peptide directed towards the N terminal region of human KIAA1627 |
| Conjugation: | Unconjugated |
| Alternative Names: | hMETTL14 |
| Rabbit polyclonal antibody to METTL14 |
| Clonality: | Polyclonal |
| Concentration: | 0.5 mg/ml |
| Molecular Weight: | 52 kDa |
| NCBI: | 066012 |
| UniProt: | Q9HCE5 |
| Buffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: | Synthetic peptide located within the following region: LNSKDEQREIAETRETCRASYDTSAPNAKRKYLDEGETDEDKMEEYKDEL |
| Target: | METTL14 |
|
|
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 0.02 ug/mL of the antibody was used in this experiment. |
|
|
Sample Tissue: Human PANC1, Antibody Dilution: 1.0 ug/mL. |
|
|
Sample Tissue: Human HCT116 Whole Cell, Antibody Dilution: 3 ug/mL. |
|
|
Positive control (+): Human Ovary (OV), Negative control (-): Human liver (LI), Antibody concentration: 1 ug/mL. |
|
|
WB Suggested Anti-KIAA1627 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:1562500, Positive Control: NCI-H226 cell lysate. |
Product Guarantee and Expert Support
