COPA Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB325700
- Images (6)
| Article Name: | COPA Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: | BYT-ORB325700 |
| Supplier Catalog Number: | orb325700 |
| Alternative Catalog Number: | BYT-ORB325700-100 |
| Manufacturer: | Biorbyt |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | WB |
| Species Reactivity: | Human |
| Immunogen: | The immunogen is a synthetic peptide directed towards the N terminal region of human COPA |
| Conjugation: | Unconjugated |
| Alternative Names: | anti FLJ26320 antibody, anti HEP-COP antibody |
| Rabbit polyclonal antibody to COPA |
| Clonality: | Polyclonal |
| Concentration: | 0.5 mg/ml |
| Molecular Weight: | 138 kDa |
| NCBI: | 004362 |
| UniProt: | P53621 |
| Buffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: | Synthetic peptide located within the following region: PWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFHKQQPLFVSGGD |
| Target: | COPA |
|
|
25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 6-18% SDS-PAGE gel. 0.5 ug/mL of the antibody was used in this experiment. |
|
|
Sample Tissue: Human Hela, Antibody Dilution: 1.0 ug/mL. |
|
|
Sample Type: Hela Whole Cell lysates, Antibody Dilution: 3.0 ug/mL. |
|
|
Sample Type: Hela Whole Cell lysates, Antibody Dilution: 3 ug/mL. |
|
|
Positive control (+): Hela (HL), Negative control (-): Human heart (HE), Antibody concentration: 1 ug/mL. |
|
|
WB Suggested Anti-COPA Antibody Titration: 0.2-1 ug/mL, Positive Control: Hela cell lysate, COPA is strongly supported by BioGPS gene expression data to be expressed in Human HeLa cells. |
Product Guarantee and Expert Support
