C17orf71 Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB326150
- Images (6)
| Article Name: | C17orf71 Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: | BYT-ORB326150 |
| Supplier Catalog Number: | orb326150 |
| Alternative Catalog Number: | BYT-ORB326150-100 |
| Manufacturer: | Biorbyt |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | WB |
| Species Reactivity: | Human |
| Immunogen: | The immunogen is a synthetic peptide directed towards the middle region of human C17orf71 |
| Conjugation: | Unconjugated |
| Alternative Names: | anti FLJ10587 antibody, anti C17orf71 antibody |
| Rabbit polyclonal antibody to SMG8 |
| Clonality: | Polyclonal |
| Concentration: | 0.5 mg/ml |
| Molecular Weight: | 110kDa |
| NCBI: | 060619 |
| UniProt: | Q8ND04 |
| Buffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: | Synthetic peptide located within the following region: HCVHKFHSLPKSGEKPEADRNPPVLYHNSRARSTGACNCGRKQAPRDDPF |
| Target: | SMG8 |
|
|
Sample Type: Human Adult Placenta, Antibody Dilution: 1.0 ug/mL. |
|
|
Sample Type: Human Fetal Brain, Antibody Dilution: 1.0 ug/mL. |
|
|
Sample Type: Human Fetal Heart, Antibody Dilution: 1.0 ug/mL. |
|
|
Sample Type: Human Fetal Liver, Antibody Dilution: 1.0 ug/mL. |
|
|
Sample Type: Human Fetal Lung, Antibody Dilution: 1.0 ug/mL. |
|
|
WB Suggested Anti-C17orf71 Antibody Titration: 0.2-1 ug/mL, Positive Control: 721_B cell lysate, SMG8 is supported by BioGPS gene expression data to be expressed in 721_B. |
Product Guarantee and Expert Support
