CALB1 Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB326328
| Article Name: |
CALB1 Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: |
BYT-ORB326328 |
| Supplier Catalog Number: |
orb326328 |
| Alternative Catalog Number: |
BYT-ORB326328-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
IHC, WB |
| Species Reactivity: |
Frog, Human |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the C terminal region of human CALB1 |
| Conjugation: |
Unconjugated |
| Alternative Names: |
anti CALB antibody |
| Rabbit polyclonal antibody to CALB1 |
| Clonality: |
Polyclonal |
| Concentration: |
0.5 mg/ml |
| Molecular Weight: |
30kDa |
| NCBI: |
004920 |
| UniProt: |
P05937 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: |
Synthetic peptide located within the following region: EFNKAFELYDQDGNGYIDENELDALLKDLCEKNKQDLDINNITTYKKNIM |
| Target: |
CALB1 |
![]()
|
Application: IHC, Species+tissue/cell type: Tadpole tegmenta horizontal section, Primary antibody Dilution: 1:500, Secondary antibody: Donkey anti-rabbit Alexa 488, Secondary antibody Dilution: 1:500. |
![]()
|
CALB1 antibody - C-terminal region (orb326328) validated by WB using COLO205 cells lysate at 1 ug/mL. |
![]()
|
CALB1 Antibody (orb326328) tested in Purkinje neurons in human cerebellum> Calbindin 1 was detected using HRP/DAB brown color stain. |
![]()
|
Primary Antibody Dilution: 1:500, Secondary Antibody: Donkey anti-rabbit Alexa 488, Secondary Antibody Dilution: 1:500, Gene Name: CALB1. |
![]()
|
Primary Antibody Dilution: 1:500, Secondary Antibody: Donkey anti-rabbit Alexa 488, Secondary Antibody Dilution: 1:500, Gene Name: CALB1. |
![]()
|
Species+tissue/cell type: Tadpole forebrain horizontal section, Primary antibody Dilution: 1:500, Secondary antibody: Donkey anti-rabbit Alexa 488, Secondary antibody Dilution: 1:500. |
