ESRRG Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB329614
| Article Name: |
ESRRG Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: |
BYT-ORB329614 |
| Supplier Catalog Number: |
orb329614 |
| Alternative Catalog Number: |
BYT-ORB329614-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
IHC, WB |
| Species Reactivity: |
Human, Mouse |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of human ESRRG |
| Conjugation: |
Unconjugated |
| Alternative Names: |
anti ERR3 antibody, anti NR3B3 antibody, anti ERRgamma antibody |
| Rabbit polyclonal antibody to ESRRG |
| Clonality: |
Polyclonal |
| Concentration: |
1.0 mg/ml |
| Molecular Weight: |
51kDa |
| NCBI: |
996318 |
| UniProt: |
P62508 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: |
Synthetic peptide located within the following region: RIDAENSPYLNPQLVQPAKKPYNKIVSHLLVAEPEKIYAMPDPTVPDSDI |
| Target: |
ESRRG |
![]()
|
Sample Tissue: Mouse Brain, Antibody Dilution: 1 ug/mL. |
![]()
|
Sample Type: Jurkat, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 2.5 ug/mL, Peptide Concentration: 2.0 ug/mL, Lysate Quantity: 25 ug/lane, Gel Concentration: 12%. |
![]()
|
Positive control (+): Mouse kidney (M-KI), Negative control (-): Mouse small intestine (M-IN), Antibody concentration: 3 ug/mL. |
![]()
|
Human Lung |
![]()
|
WB Suggested Anti-ESRRG Antibody Titration: 0.5 ug/mL, ELISA Titer: 1:62500, Positive Control: Jurkat cell lysate. |
