RORA Rabbit Polyclonal Antibody, Unconjugated

Catalog Number: BYT-ORB329792
Article Name: RORA Rabbit Polyclonal Antibody, Unconjugated
Biozol Catalog Number: BYT-ORB329792
Supplier Catalog Number: orb329792
Alternative Catalog Number: BYT-ORB329792-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RORA
Conjugation: Unconjugated
Alternative Names: anti MGC119326 antibody, anti MGC119329 antibody, anti NR1F1 antibody, anti ROR1 antibody, anti ROR2 antibody, anti ROR3 antibody, anti RZRA antibody, anti RZR-ALPHA antibody
Rabbit polyclonal antibody to RORA
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 59 kDa
NCBI: 599024
UniProt: P35398
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: GFMELCQNDQIVLLKAGSLEVVFIRMCRAFDSQNNTVYFDGKYASPDVFK
Target: RORA
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment.
Sample Tissue: Mouse Liver, Antibody Dilution: 1 ug/mL.
Sample Type: Human Adult Placenta, Antibody Dilution: 1.0 ug/mL.
Sample Type: Human Fetal Heart, Antibody Dilution: 1.0 ug/mL.
WB Suggested Anti-RORA Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:1562500, Positive Control: 721_B cell lysate, RORA is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.