KCNMA1 Rabbit Polyclonal Antibody, Unconjugated

Catalog Number: BYT-ORB329808
Article Name: KCNMA1 Rabbit Polyclonal Antibody, Unconjugated
Biozol Catalog Number: BYT-ORB329808
Supplier Catalog Number: orb329808
Alternative Catalog Number: BYT-ORB329808-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human
Immunogen: The immunogen is a synthetic peptide directed towards the c terminal region of human KCNMA1
Conjugation: Unconjugated
Alternative Names: anti BKTM antibody, anti DKFZp686K1437 antibody, anti KCa1.1 antibody, anti MGC71881 antibody, anti MaxiK antibody, anti SAKCA antibody, anti SLO antibody, anti SLO-ALPHA antibody, anti mSLO1 antibody, anti SLO1 antibody, anti bA205K10.1 antibody
Rabbit polyclonal antibody to KCNMA1
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 131kDa
NCBI: 001014797
UniProt: Q12791
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: CFGIYRLRDAHLSTPSQCTKRYVITNPPYEFELVPTDLIFCLMQFDHNAG
Target: KCNMA1
Sample Type: HepG2, Antibody Dilution: 1.0 ug/mL.
Sample Type: Jurkat, Antibody Dilution: 1.0 ug/mL.
KCNMA1 antibody - C-terminal (orb329808), Catalog Number: orb329808, Formalin Fixed Paraffin Embedded Tissue: Human Pineal Tissue, Observed Staining: Cytoplasm in Human Pineal Tissue, Primary Antibody Concentration: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5 - 2.0 sec.
Prostate
WB Suggested Anti-KCNMA1 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: Human Liver.