KCNN2 Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB329809
| Article Name: |
KCNN2 Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: |
BYT-ORB329809 |
| Supplier Catalog Number: |
orb329809 |
| Alternative Catalog Number: |
BYT-ORB329809-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
IHC, WB |
| Species Reactivity: |
Human, Monkey, Rat |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the C terminal region of human KCNN2 |
| Conjugation: |
Unconjugated |
| Alternative Names: |
anti SK2 antibody, anti hSK2 antibody, anti SKCA2 antibody, anti KCa2.2 antibody |
| Rabbit polyclonal antibody to KCNN2 |
| Clonality: |
Polyclonal |
| Concentration: |
1.0 mg/ml |
| Molecular Weight: |
64kDa |
| NCBI: |
067627 |
| UniProt: |
Q9H2S1 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: |
Synthetic peptide located within the following region: IDHAKVRKHQRKFLQAIHQLRSVKMEQRKLNDQANTLVDLAKTQNIMYDM |
| Target: |
KCNN2 |
![]()
|
Sample Tissue: Human Fetal Liver, Antibody Dilution: 1.0 ug/mL. |
![]()
|
Sample Type: HepG2, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 2.5 ug/mL, Peptide Concentration: 2.0 ug/mL, Lysate Quantity: 25 ug/lane, Gel Concentration: 12%. |
![]()
|
Positive control (+): Human liver (LI), Negative control (-): 293T (2T), Antibody concentration: 0.5 ug/mL. |
![]()
|
Lanes: Rat brain section, Primary Antibody Dilution: 1:500, Secondary Antibody: Anti-rabbit-biotin, streptavidin-diaminobenzidine, Secondary Antibody Dilution: 1:500, Gene Name: KCNN2. |
![]()
|
Sample Type: Rhesus macaque spinal cord, Primary Antibody Dilution: 1:300, Secondary Antibody: Donkey anti Rabbit 488, Secondary Antibody Dilution: 1:500, Color/Signal Descriptions: Green: KCNN2, Gene Name: KCNN2. |
![]()
|
WB Suggested Anti-KCNN2 Antibody Titration: 1.25 ug/mL, ELISA Titer: 1:62500, Positive Control: HepG2 cell lysate. |
