ZFP42 Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB329864
- Images (5)
| Article Name: | ZFP42 Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: | BYT-ORB329864 |
| Supplier Catalog Number: | orb329864 |
| Alternative Catalog Number: | BYT-ORB329864-100 |
| Manufacturer: | Biorbyt |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | WB |
| Species Reactivity: | Human |
| Immunogen: | The immunogen is a synthetic peptide directed towards the N terminal region of human ZFP42 |
| Conjugation: | Unconjugated |
| Alternative Names: | anti REX1 antibody, anti ZNF754 antibody |
| Rabbit polyclonal antibody to ZFP42 |
| Clonality: | Polyclonal |
| Concentration: | 0.5 mg/ml |
| Molecular Weight: | 35kDa |
| NCBI: | 777560 |
| UniProt: | Q96MM3 |
| Buffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: | Synthetic peptide located within the following region: MSQQLKKRAKTRHQKGLGGRAPSGAKPRQGKSSQDLQAEIEPVSAVWALC |
| Target: | ZFP42 |
|
|
WB Suggested Anti-ZFP42 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: Jurkat cell lysate. |
|
|
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment. |
|
|
Sample Tissue: Human Jurkat Whole Cell, Antibody Dilution: 3 ug/mL. |
|
|
Sample Tissue: Human Jurkat, Antibody Dilution: 1.0 ug/mL. |
|
|
Sample Type: 721_B Whole cell lysates, Antibody Dilution: 1.0 ug/mL. |
Product Guarantee and Expert Support
