Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: DHLKTHTRTHTGEKPFSCRWPSCQKKFARSDELVRHHNMHQRNMTKLQLA
Target:
WT1
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment. The middle peptide is contained within multiple isoforms of this protein from 63 kDa to 33 kDa (~10 isoforms), and at least 4 of these isoforms seem represented in samples shown (63 kDa, 47-49 kDa, 40 kDa, and 33 kDa).
