TARDBP Rabbit Polyclonal Antibody, Unconjugated

Catalog Number: BYT-ORB330029
Article Name: TARDBP Rabbit Polyclonal Antibody, Unconjugated
Biozol Catalog Number: BYT-ORB330029
Supplier Catalog Number: orb330029
Alternative Catalog Number: BYT-ORB330029-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human TARDBP
Conjugation: Unconjugated
Alternative Names: anti ALS10 antibody, anti TDP-43 antibody
Rabbit polyclonal antibody to TARDBP
Clonality: Polyclonal
Concentration: 1.0 mg/ml
Molecular Weight: 45kDa
NCBI: 031401
UniProt: Q13148
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: MGMLASQQNQSGPSGNNQNQGNMQREPNQAFGSGNNSYSGSNSGAAIGWG
Target: TARDBP
Sample Type: Jurkat, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1.25 ug/mL, Peptide Concentration: 1.0 ug/mL, Lysate Quantity: 25 ug/lane, Gel Concentration: 12%.
Human Heart
Human Liver
Rabbit Anti-TARDBP antibody, Paraffin Embedded Tissue: Human Heart, cell Cellular Data: cardiac cell, Antibody Concentration: 4.0-8.0 ug/mL Magnification: 400X.
WB Suggested Anti-TARDBP Antibody Titration: 1.25 ug/mL, Positive Control: Jurkat cell lysate, TARDBP is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells.