Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: MAWDMCNQDSESVWSDIECAALVGEDQPLCPDLPELDLSELDVNDLDTDS
Target:
PPARGC1A
25 ug of the indicated Mouse whole cell extracts was loaded onto a 6-18% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment. Recommended dilution for antibody is 1-3 ug/mL.
Lanes: Lane 1: 30 ug Human liver, Lane 2: 30 ug Rat liver, Lane 3: 30 ug Mouse (wild-type) liver, Lane 4: 30 ug Mouse [AMPK alpha 1/2(-/-)] liver, Lane 5: 30 ug Human muscle, Lane 6: 30 ug Rat muscle, Lane 7: 30 ug Mouse muscle, Primary Antibody Dilution: 1:1000, Secondary Antibody Dilution: 1:10000, Gene Name: PPARGC1A.
PPARGC1A antibody - N-terminal region (orb330034) validated by WB using Transfected Melanoma Cell at 1:1000.
PPARGC1A antibody - N-terminal region (orb330034) validated by WB using transfected SH-SY5Y lysate at 1:15000.
