IGF2BP2 Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB330141
- Images (6)
| Article Name: | IGF2BP2 Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: | BYT-ORB330141 |
| Supplier Catalog Number: | orb330141 |
| Alternative Catalog Number: | BYT-ORB330141-100 |
| Manufacturer: | Biorbyt |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | WB |
| Species Reactivity: | Human |
| Immunogen: | The immunogen is a synthetic peptide directed towards the middle region of human IGF2BP2 |
| Conjugation: | Unconjugated |
| Alternative Names: | Anti-A170 antibody, anti-EBI 3 associated protein of 60 kDa antibody, anti-EBI 3 associated protein p60 antibody, anti-EBI3 associated protein of 60 kDa antibody, anti-EBI3 associated protein p60 antibody, anti-EBI3-associated protein of 60 kDa antibody, anti-EBIAP antibody, anti-FTDALS3 antibody, anti-MGC127197 antibody, anti-ORCA antibody, anti-OSF-6 antibody, anti-Osi antibody, anti-OSIL antibody, anti-Oxidative stress induced like antibody, anti-p60 antibody, anti-p62 antibody, anti-p62B antibody, anti-Paget disease of bone 3 antibody, anti-PDB 3 antibody, anti-PDB3 antibody, anti-Phosphotyrosine independent ligand for the Lck SH2 domain of 62 kDa antibody, anti-Phosphotyrosine independent ligand for the Lck SH2 domain p62 antibody, anti-Phosphotyrosine-independent ligand for the Lck SH2 domain of 62 kDa antibody, anti-PKC-zeta-interacting protein antibody, anti-Protein kinase C-zeta-interacting protein antibody, anti-Sequestosome 1 antibody, anti-Sequestosome-1 antibody, anti-SQSTM 1 antibody, anti-SQSTM_HUMAN antibody, anti-Sqstm1 antibody, anti-STAP antibody, anti-STONE14 antibody, anti-Ubiquitin binding protein p62 antibody, anti-Ubiquitin-binding protein p62 antibody, anti-ZIP 3 antibody, anti-ZIP antibody, anti-ZIP3 antibody |
| Rabbit polyclonal antibody to IGF2BP2 |
| Clonality: | Polyclonal |
| Concentration: | 0.5 mg/ml |
| Molecular Weight: | 66kDa |
| NCBI: | 006539 |
| UniProt: | Q9Y6M1 |
| Buffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: | Synthetic peptide located within the following region: QANLIPGLNLSALGIFSTGLSVLSPPAGPRGAPPAAPYHPFTTHSGYFSS |
| Target: | IGF2BP2 |
|
|
Sample Type: Human Adult Placenta, Antibody Dilution: 1.0 ug/mL. |
|
|
Sample Type: Human Adult Placenta, Antibody Dilution: 1.0 ug/mL. |
|
|
Sample Type: Human Fetal Heart, Antibody Dilution: 1.0 ug/mL. |
|
|
Sample Type: Human Fetal Liver, Antibody Dilution: 1.0 ug/mL. |
|
|
Sample Type: Human Fetal Lung, Antibody Dilution: 1.0 ug/mL. |
|
|
WB Suggested Anti-IGF2BP2 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:1562500, Positive Control: HT1080 cell lysate, IGF2BP2 is supported by BioGPS gene expression data to be expressed in HT1080. |
Product Guarantee and Expert Support
