FZD7 Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB330165
| Article Name: |
FZD7 Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: |
BYT-ORB330165 |
| Supplier Catalog Number: |
orb330165 |
| Alternative Catalog Number: |
BYT-ORB330165-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
IHC, WB |
| Species Reactivity: |
Human |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the C terminal region of human FZD7 |
| Conjugation: |
Unconjugated |
| Alternative Names: |
anti FzE3 antibody |
| Rabbit polyclonal antibody to FZD7 |
| Clonality: |
Polyclonal |
| Concentration: |
0.5 mg/ml |
| Molecular Weight: |
63kDa |
| NCBI: |
003498 |
| UniProt: |
O75084 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: |
Synthetic peptide located within the following region: PDFTVFMIKYLMTMIVGITTGFWIWSGKTLQSWRRFYHRLSHSSKGETAV |
| Target: |
FZD7 |
![]()
|
Sample Tissue: Human A549 Whole Cell, Antibody Dilution: 1 ug/mL. |
![]()
|
Sample Tissue: Human Ovary Tumor, Antibody Dilution: 1.0 ug/mL. |
![]()
|
Positive control (+): HepG2 (HG), Negative control (-): Human liver (LI), Antibody concentration: 0.2 ug/mL. |
![]()
|
Rabbit Anti-FZD7 Antibody, Paraffin Embedded Tissue: Human Kidney, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/mL, Magnification: 400X. |
![]()
|
WB Suggested Anti-FZD7 Antibody Titration: 0.2-1 ug/mL, Positive Control: HepG2 cell lysate. |
