SLC39A5 Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB330368
| Article Name: |
SLC39A5 Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: |
BYT-ORB330368 |
| Supplier Catalog Number: |
orb330368 |
| Alternative Catalog Number: |
BYT-ORB330368-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
IHC, WB |
| Species Reactivity: |
Human |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the N terminal region of human SLC39A5 |
| Conjugation: |
Unconjugated |
| Alternative Names: |
anti LZT-Hs7 antibody, anti MGC34778 antibody, anti ZIP5 antibody |
| Rabbit polyclonal antibody to SLC39A5 |
| Clonality: |
Polyclonal |
| Concentration: |
0.5 mg/ml |
| Molecular Weight: |
56kDa |
| NCBI: |
775867 |
| UniProt: |
Q6ZMH5 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: |
Synthetic peptide located within the following region: MGSPVSHLLAGFCVWVVLGWVGGSVPNLGPAEQEQNHYLAQLFGLYGENG |
| Target: |
SLC39A5 |
![]()
|
Sample Tissue: Human Jurkat Whole Cell, Antibody Dilution: 1 ug/mL. |
![]()
|
Human Liver |
![]()
|
Rabbit Anti-SLC39A5 antibody, Formalin Fixed Paraffin Embedded Tissue: Human Colon, Primary antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec. |
![]()
|
Rabbit Anti-SLC39A5 antibody, Formalin Fixed Paraffin Embedded Tissue: Human Prostate, Primary antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec. |
![]()
|
Rabbit Anti-SLC39A5 antibody, Formalin Fixed Paraffin Embedded Tissue: Human Uterus, Primary antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec. |
![]()
|
WB Suggested Anti-SLC39A5 Antibody Titration: 0.5 ug/mL, Positive Control: HepG2 cell lysate. |
