ALDH3A2 Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB330379
| Article Name: |
ALDH3A2 Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: |
BYT-ORB330379 |
| Supplier Catalog Number: |
orb330379 |
| Alternative Catalog Number: |
BYT-ORB330379-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Human |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of human ALDH3A2 |
| Conjugation: |
Unconjugated |
| Alternative Names: |
anti ALDH10 antibody, anti DKFZp686E23276 antibody, anti FALDH antibody, anti FLJ20851 antibody, anti SLS antibody |
| Rabbit polyclonal antibody to ALDH3A2 |
| Clonality: |
Polyclonal |
| Concentration: |
0.5 mg/ml |
| Molecular Weight: |
58kDa |
| NCBI: |
001026976 |
| UniProt: |
P51648 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: |
Synthetic peptide located within the following region: DHIFYTGNTAVGKIVMEAAAKHLTPVTLELGGKSPCYIDKDCDLDIVCRR |
| Target: |
ALDH3A2 |
![]()
|
Sample Type: Human Fetal Liver, Antibody Dilution: 1.0 ug/mL. |
![]()
|
Sample Type: Human Fetal Lung, Antibody Dilution: 1.0 ug/mL. |
![]()
|
Rabbit Anti-ALDH3A2 antibody, Formalin Fixed Paraffin Embedded Tissue: Human Adult Adrenal, Observed Staining: Cytoplasm in hepatocytes, Primary Antibody Concentration: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5 - 2.0 sec. |
![]()
|
WB Suggested Anti-ALDH3A2 Antibody, Positive Control: Lane 1: 30 ug human primary hepatocytes, Primary Antibody Dilution: 1:1000, Secondary Antibody: Anti-rabbit-HRP, Secondry Antibody Dilution: 1:5000. |
![]()
|
WB Suggested Anti-ALDH3A2 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:1562500, Positive Control: NCI-H226 cell lysate. |
