RORC Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB330428
- Images (7)
| Article Name: | RORC Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: | BYT-ORB330428 |
| Supplier Catalog Number: | orb330428 |
| Alternative Catalog Number: | BYT-ORB330428-100 |
| Manufacturer: | Biorbyt |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC-P, WB |
| Species Reactivity: | Human |
| Immunogen: | The immunogen is a synthetic peptide directed towards the N terminal region of human RORC |
| Conjugation: | Unconjugated |
| Alternative Names: | anti MGC129539 antibody, anti NR1F3 antibody, anti RORG antibody, anti RZRG antibody, anti TOR antibody, anti RZR-GAMMA antibody |
| Rabbit polyclonal antibody to RORC |
| Clonality: | Polyclonal |
| Concentration: | 0.5 mg/ml |
| Molecular Weight: | 58 kDa |
| NCBI: | 001001523 |
| UniProt: | Q5SZR9 |
| Buffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: | Synthetic peptide located within the following region: EPVVKTPPAGAQGADTLTYTLGLPDGQLPLGSSPDLPEASACPPGLLKAS |
| Target: | RORC |
|
|
25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment. |
|
|
Anti-ROR Gamma antibody IHC of human brain, cortex. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/mL. |
|
|
Anti-ROR Gamma antibody IHC of human testis. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/mL. |
|
|
Sample Tissue: Human Lung Tumor, Antibody Dilution: 3 ug/mL. |
|
|
Sample Tissue: Human MCF7 Whole Cell, Antibody Dilution: 1 ug/mL. |
|
|
Positive control (+): Human lung (LU), Negative control (-): HepG2 (HG), Antibody concentration: 1 ug/mL. |
|
|
WB Suggested Anti-RORC Antibody Titration: 1 ug/mL, Positive Control: HepG2 cell lysate. |
Product Guarantee and Expert Support
