PSAT1 Rabbit Polyclonal Antibody, Unconjugated

Catalog Number: BYT-ORB330478
Article Name: PSAT1 Rabbit Polyclonal Antibody, Unconjugated
Biozol Catalog Number: BYT-ORB330478
Supplier Catalog Number: orb330478
Alternative Catalog Number: BYT-ORB330478-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PSAT1
Conjugation: Unconjugated
Alternative Names: anti EPIP antibody, anti MGC1460 antibody, anti PSA antibody, anti PSAT antibody
Rabbit polyclonal antibody to PSAT1
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 40kDa
NCBI: 478059
UniProt: Q9Y617
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: ADYVVTGAWSAKAAEEAKKFGTINIVHPKLGSYTKIPDPSTWNLNPDASY
Target: PSAT1
Sample Tissue: Human Fetal Kidney, Antibody Dilution: 1.0 ug/mL.
Human kidney
Rabbit Anti-PSAT1 antibody, Formalin Fixed Paraffin Embedded Tissue: Human Brain, Cortex, Primary antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.
Rabbit Anti-PSAT1 antibody, Formalin Fixed Paraffin Embedded Tissue: Human Spleen, Primary antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.
WB Suggested Anti-PSAT1 Antibody Titration: 1 ug/mL, Positive Control: HepG2 cell lysate, PSAT1 is supported by BioGPS gene expression data to be expressed in HepG2.