EIF3E Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB330533
| Article Name: |
EIF3E Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: |
BYT-ORB330533 |
| Supplier Catalog Number: |
orb330533 |
| Alternative Catalog Number: |
BYT-ORB330533-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Human |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of human EIF3E |
| Conjugation: |
Unconjugated |
| Alternative Names: |
anti EIF3-P48 antibody, anti EIF3S6 antibody, anti INT6 antibody, anti eIF3-p46 antibody |
| Rabbit polyclonal antibody to EIF3E |
| Clonality: |
Polyclonal |
| Concentration: |
0.5 mg/ml |
| Molecular Weight: |
52kDa |
| NCBI: |
001559 |
| UniProt: |
P60228 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: |
Synthetic peptide located within the following region: LNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVIEKTK |
| Target: |
EIF3E |
![]()
|
Sample Tissue: Human Hela Whole Cell, Antibody dilution: 1 ug/ml. |
![]()
|
Sample Type: Human Fetal Lung, Antibody dilution: 1.0 ug/ml. |
![]()
|
Rabbit Anti-EIF3E Antibody, Catalog Number: orb330533, Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue, Observed Staining: Cytoplasmic, nucleus, Primary Antibody Concentration: 1:100, Other Working Concentrations: N/A, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec. |
![]()
|
Sample Type: 1. B8 mouse fibroblast cells, extraction only2. Human total cell extractPrimary dilution: 1:1000, Secondary Anitbody: HRP conjugated anti-rabbit. |
![]()
|
WB Suggested Anti-EIF3E Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: HepG2 cell lysate. |
