HSPA8 Rabbit Polyclonal Antibody, Unconjugated

Catalog Number: BYT-ORB330555
Article Name: HSPA8 Rabbit Polyclonal Antibody, Unconjugated
Biozol Catalog Number: BYT-ORB330555
Supplier Catalog Number: orb330555
Alternative Catalog Number: BYT-ORB330555-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human, Rat
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HSPA8
Conjugation: Unconjugated
Alternative Names: anti HSC54 antibody, anti HSC70 antibody, anti HSC71 antibody, anti HSP71 antibody, anti HSP73 antibody, anti HSPA10 antibody, anti LAP1 antibody, anti MGC131511 antibody, anti MGC29929 antibody, anti NIP71 antibody
Rabbit polyclonal antibody to HSPA8
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 71kDa
NCBI: 006588
UniProt: P11142
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: VVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAE
Target: HSPA8
Anti-HSPA8 / HSC70 antibody IHC staining of human spleen. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibodyconcentration 5 ug/ml.
Anti-HSPA8 / HSC70 antibody IHC staining of human tonsil. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.
Application: IHC, Species+tissue/cell type: Human brain stem cells, Primary antibody dilution: 1:500, Secondary antibody: Goat anti-rabbit Alexa-Fluor 594, Secondary antibody dilution: 1:1000.
Titer: 1:1000, Positive Control: Rat Brain Lysate.
WB Suggested Anti-HSPA8 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: COLO205 cell lysate.