Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: QDIAMAKSAKLIQQQLEKELNTLRVTRSAAPSTLYSSSTAPAQLGKKGKE
Target:
SRPRB
25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment.
Sample Type: 721_B, Antibody dilution: 1.0 ug/ml. SRPRB is supported by BioGPS gene expression data to be expressed in 721_B.
Sample Type: Hela, Antibody dilution: 1.0 ug/ml. SRPRB is supported by BioGPS gene expression data to be expressed in HeLa.
Sample Type: Jurkat, Antibody dilution: 1.0 ug/ml. SRPRB is supported by BioGPS gene expression data to be expressed in Jurkat.
Positive control (+): MCF7 Cell Lysate (N10), Negative control (-): NTERA-2 Cell Lysate (N27), Antibody concentration: 1 ug/ml.
Rabbit Anti-SRPRB Antibody, Catalog Number: orb330594, Formalin Fixed Paraffin Embedded Tissue: Human Bronchial Epithelial Tissue, Observed Staining: Cytoplasmic, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1/600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.
WB Suggested Anti-SRPRB Antibody Titration: 0.2-1 ug/ml, Positive Control: Hela cell lysate, SRPRB is supported by BioGPS gene expression data to be expressed in HeLa.
* VAT and and shipping costs not included. Errors and price changes excepted
