Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: WNANTQWCLERHGVDVDVSVFDVVANPGQTFRGPDMTIFYSSQLGTYPYY
Target:
HYAL1
Sample Type: Human Fetal Brain, Antibody dilution: 1.0 ug/ml.
Sample Type: Human Fetal Lung, Antibody dilution: 1.0 ug/ml.
Positive control (+): HepG2 (HG), Negative control (-): Human Ovary (OV), Antibody concentration: 0.5 ug/ml.
HYAL1 antibody - N-terminal region (orb330624) validated by WB using HepG2 cell lysate at 1 ug/ml. HYAL1 is supported by BioGPS gene expression data to be expressed in HepG2.
Immunohistochemistry with breast cancer tissue tissue.
Immunohistochemistry with Human Liver cell lysate tissue at an antibody concentration of 5.0 ug/ml using anti-HYAL1 antibody (orb330624).
* VAT and and shipping costs not included. Errors and price changes excepted