HYAL1 Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB330624
- Images (6)
| Article Name: | HYAL1 Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: | BYT-ORB330624 |
| Supplier Catalog Number: | orb330624 |
| Alternative Catalog Number: | BYT-ORB330624-100 |
| Manufacturer: | Biorbyt |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | The immunogen is a synthetic peptide directed towards the N terminal region of human HYAL1 |
| Conjugation: | Unconjugated |
| Alternative Names: | anti HYAL-1 antibody, anti LUCA1 antibody, anti MGC45987 antibody, anti NAT6 antibody |
| Rabbit polyclonal antibody to HYAL1 |
| Clonality: | Polyclonal |
| Concentration: | 0.5 mg/ml |
| Molecular Weight: | 45kDa |
| NCBI: | 695014 |
| UniProt: | Q12794 |
| Buffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: | Synthetic peptide located within the following region: WNANTQWCLERHGVDVDVSVFDVVANPGQTFRGPDMTIFYSSQLGTYPYY |
| Target: | HYAL1 |
|
|
Sample Type: Human Fetal Brain, Antibody dilution: 1.0 ug/ml. |
|
|
Sample Type: Human Fetal Lung, Antibody dilution: 1.0 ug/ml. |
|
|
Positive control (+): HepG2 (HG), Negative control (-): Human Ovary (OV), Antibody concentration: 0.5 ug/ml. |
|
|
HYAL1 antibody - N-terminal region (orb330624) validated by WB using HepG2 cell lysate at 1 ug/ml. HYAL1 is supported by BioGPS gene expression data to be expressed in HepG2. |
|
|
Immunohistochemistry with breast cancer tissue tissue. |
|
|
Immunohistochemistry with Human Liver cell lysate tissue at an antibody concentration of 5.0 ug/ml using anti-HYAL1 antibody (orb330624). |
Product Guarantee and Expert Support
