ACTR1B Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB330662
- Images (6)
| Article Name: | ACTR1B Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: | BYT-ORB330662 |
| Supplier Catalog Number: | orb330662 |
| Alternative Catalog Number: | BYT-ORB330662-100 |
| Manufacturer: | Biorbyt |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | WB |
| Species Reactivity: | Human |
| Immunogen: | The immunogen is a synthetic peptide directed towards the C terminal region of human ACTR1B |
| Conjugation: | Unconjugated |
| Alternative Names: | anti ARP1B antibody, anti CTRN2 antibody, anti PC3 antibody |
| Rabbit polyclonal antibody to ACTR1B |
| Clonality: | Polyclonal |
| Concentration: | 0.5 mg/ml |
| Molecular Weight: | 42kDa |
| NCBI: | 005726 |
| UniProt: | P42025 |
| Buffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: | Synthetic peptide located within the following region: KIKISAPQERLYSTWIGGSILASLDTFKKMWVSKKEYEEDGSRAIHRKTF |
| Target: | ACTR1B |
|
|
Sample Type: Human 721_B, Antibody dilution: 1.0 ug/ml. ACTR1B is supported by BioGPS gene expression data to be expressed in 721_B. |
|
|
Sample Type: Human Fetal Brain, Antibody dilution: 1.0 ug/ml. |
|
|
Sample Type: Human Fetal Heart, Antibody dilution: 1.0 ug/ml. |
|
|
Sample Type: Human Fetal Liver, Antibody dilution: 1.0 ug/ml. |
|
|
Sample Type: Human Fetal Lung, Antibody dilution: 1.0 ug/ml. |
|
|
WB Suggested Anti-ACTR1B Antibody Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate, ACTR1B is supported by BioGPS gene expression data to be expressed in HepG2. |
Product Guarantee and Expert Support
