TRIB1 Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB330687
| Article Name: |
TRIB1 Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: |
BYT-ORB330687 |
| Supplier Catalog Number: |
orb330687 |
| Alternative Catalog Number: |
BYT-ORB330687-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
IHC, WB |
| Species Reactivity: |
Human |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of human TRIB1 |
| Conjugation: |
Unconjugated |
| Alternative Names: |
anti C8FW antibody, anti GIG2 antibody, anti SKIP1 antibody, anti TRB1 antibody |
| Rabbit polyclonal antibody to TRIB1 |
| Clonality: |
Polyclonal |
| Concentration: |
0.5 mg/ml |
| Molecular Weight: |
41 kDa |
| NCBI: |
079471 |
| UniProt: |
Q96RU8 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: |
Synthetic peptide located within the following region: TEERTQLRLESLEDTHIMKGEDDALSDKHGCPAYVSPEILNTTGTYSGKA |
| Target: |
TRIB1 |
![]()
|
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. |
![]()
|
Sample Tissue: Human Stomach Tumor, Antibody dilution: 1.0 ug/ml. |
![]()
|
Sample Type: COLO205, Antibody dilution: 1.0 ug/ml. TRIB1 is supported by BioGPS gene expression data to be expressed in COLO205. |
![]()
|
Positive control (+): Human intestine (IN), Negative control (-): THP-1 (N30), Antibody concentration: 1 ug/ml. |
![]()
|
Rabbit Anti-TRIB1 Antibody, Catalog Number: orb330687, Formalin Fixed Paraffin Embedded Tissue: Human Lung Tissue, Observed Staining: Cytoplasmic in alveolar type I & II cells, Primary Antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec. |
![]()
|
WB Suggested Anti-TRIB1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Human Intestine. |
