IDH1 Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB330779
- Images (7)
| Article Name: | IDH1 Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: | BYT-ORB330779 |
| Supplier Catalog Number: | orb330779 |
| Alternative Catalog Number: | BYT-ORB330779-100 |
| Manufacturer: | Biorbyt |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human, Rat |
| Immunogen: | The immunogen is a synthetic peptide directed towards the C terminal region of human IDH1 |
| Conjugation: | Unconjugated |
| Alternative Names: | anti IDH antibody, anti IDP antibody, anti PICD antibody, anti IDCD antibody, anti IDPC antibody |
| Rabbit polyclonal antibody to IDH1 |
| Clonality: | Polyclonal |
| Concentration: | 0.5 mg/ml |
| Molecular Weight: | 47 kDa |
| NCBI: | 005887 |
| UniProt: | O75874 |
| Buffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: | Synthetic peptide located within the following region: MMTSVLVCPDGKTVEAEAAHGTVTRHYRMYQKGQETSTNPIASIFAWTRG |
| Target: | IDH1 |
|
|
Sample type: 1. HEPG2 (50 ug), 2. Drosophila extract (50 ug), Primary dilution: 1:1000, Secondary Antibody: mouse anti-Rabbit HRP, Secondary dilution: 1:5000. |
|
|
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. |
|
|
Sample Tissue: Rat Brain, Antibody dilution: 1 ug/ml. |
|
|
IDH1 antibody - C-terminal region (orb330779) validated by WB using HEPG2 lysate + Drosophila extract at 1:1000. IDH1 is supported by BioGPS gene expression data to be expressed in HepG2. |
|
|
Rabbit Anti-IDH1 Antibody, Paraffin Embedded Tissue: Human Testis, Antibody Concentration: 5 ug/ml. |
|
|
Rabbit Anti-IDH1 Antibody, Paraffin Embedded Tissue: Human Testis, Antibody Concentration: 5 ug/ml. |
|
|
Sample Type: Human glioma cells, Primary Antibody dilution: 1:200, Secondary Antibody: Anti-rabbit-GFP, Secondary Antibody dilution: 1:5000, Color/Signal Descriptions: 1. Red: Nucleus 2. Green: IDH 3. Merge, Gene Name: IDH1. |
Product Guarantee and Expert Support
