FANCL Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB330840
| Article Name: |
FANCL Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: |
BYT-ORB330840 |
| Supplier Catalog Number: |
orb330840 |
| Alternative Catalog Number: |
BYT-ORB330840-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
IHC, WB |
| Species Reactivity: |
Human |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of human FANCL |
| Conjugation: |
Unconjugated |
| Alternative Names: |
anti FAAP43 antibody, anti FLJ10335 antibody, anti PHF9 antibody, anti POG antibody |
| Rabbit polyclonal antibody to FANCL |
| Clonality: |
Polyclonal |
| Concentration: |
0.5 mg/ml |
| Molecular Weight: |
43 kDa |
| NCBI: |
001108108 |
| UniProt: |
Q9NW38 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: |
Synthetic peptide located within the following region: ASGREHLITLKLKAKYPAESPDYFVDFPVPFCASWTPQVNSPQSSLISIY |
| Target: |
FANCL |
![]()
|
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 2 ug/ml of the antibody was used in this experiment. |
![]()
|
Sample Tissue: Human Hela Whole Cell, Antibody dilution: 1 ug/ml. |
![]()
|
Sample Tissue: Human Hela Whole Cell, Antibody dilution: 2 ug/ml. |
![]()
|
Lanes: Lane 1: 7 ug HEK293 cytoplasmic lysate, 2: 7 ug HEK293 nuclei lysate, Primary Antibody dilution: 1:1000, Secondary Antibody: Anti-rabbit-HRP, Secondary Antibody dilution: 1:3000, Gene Name: FANCL. |
![]()
|
Rabbit Anti-FANCL Antibody, Catalog Number: orb330840, Formalin Fixed Paraffin Embedded Tissue: Human Pineal Tissue, Observed Staining: Cytoplasmic and nuclear in in pinealocytes, Primary Antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec. |
![]()
|
WB Suggested Anti-FANCL Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Human heart. |
