ADRM1 Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB331037
- Images (7)
| Article Name: | ADRM1 Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: | BYT-ORB331037 |
| Supplier Catalog Number: | orb331037 |
| Alternative Catalog Number: | BYT-ORB331037-100 |
| Manufacturer: | Biorbyt |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | WB |
| Species Reactivity: | Human |
| Immunogen: | The immunogen is a synthetic peptide directed towards the C terminal region of human ADRM1 |
| Conjugation: | Unconjugated |
| Alternative Names: | anti ARM1 antibody, anti GP110 antibody, anti MGC29536 antibody, anti Rpn13 antibody |
| Rabbit polyclonal antibody to ADRM1 |
| Clonality: | Polyclonal |
| Concentration: | 0.5 mg/ml |
| Molecular Weight: | 40kDa |
| NCBI: | 783163 |
| UniProt: | Q16186 |
| Buffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: | Synthetic peptide located within the following region: QLGPLMCQFGLPAEAVEAANKGDVEAFAKAMQNNAKPEQKEGDTKDKKDE |
| Target: | ADRM1 |
|
|
Sample Tissue: Human Jurkat Whole Cell, Antibody dilution: 1 ug/ml. |
|
|
Sample Type: Human 721_B, Antibody dilution: 1.0 ug/ml. ADRM1 is supported by BioGPS gene expression data to be expressed in 721_B. |
|
|
Sample Type: Human Fetal Brain, Antibody dilution: 1.0 ug/ml. |
|
|
Sample Type: Human Fetal Heart, Antibody dilution: 1.0 ug/ml. |
|
|
Sample Type: Human Fetal Lung, Antibody dilution: 1.0 ug/ml. |
|
|
Sample Type: Human Hela, Antibody dilution: 1.0 ug/ml. ADRM1 is supported by BioGPS gene expression data to be expressed in HeLa. |
|
|
WB Suggested Anti-ADRM1 antibody, Titration: 1 ug/ml, Positive Control: HeLa cells and cytosol from male mouse liver. |
Product Guarantee and Expert Support
