The immunogen is a synthetic peptide directed towards the N terminal region of human SP7
Conjugation:
Unconjugated
Alternative Names:
anti MGC126598 antibody, anti Osterix antibody, anti Osx antibody, anti Sp 7 antibody, anti SP7 antibody, anti Sp7 transcription factor antibody, anti Transcription factor Sp7 antibody, anti Zinc finger protein osterix antibody
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: MASSLLEEEVHYGSSPLAMLTAACSKFGGSSPLRDSTTLGKAGTKKPYSV
Target:
SP7
25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. An isoform containing the peptide sequence is present at 43 kDa.
Sample Tissue: Human Fetal Lung, Antibody dilution: 1.0 ug/ml.
Immunohistochemistry with Testis tissue at an antibody concentration of 5 ug/ml using anti-SP7 antibody (orb333702).
Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/ml in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.