KL Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB333709
| Article Name: |
KL Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: |
BYT-ORB333709 |
| Supplier Catalog Number: |
orb333709 |
| Alternative Catalog Number: |
BYT-ORB333709-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
IHC, WB |
| Species Reactivity: |
Human |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of human KL |
| Conjugation: |
Unconjugated |
| Alternative Names: |
anti KL antibody, anti KLOT_HUMAN antibody, anti Klotho peptide antibody |
| Rabbit polyclonal antibody to Klotho |
| Clonality: |
Polyclonal |
| Concentration: |
0.5 mg/ml |
| Molecular Weight: |
60 kDa |
| NCBI: |
24941 |
| UniProt: |
Q9UEF7 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: |
Synthetic peptide located within the following region: GRLAPGIRGSPRLGYLVAHNLLLAHAKVWHLYNTSFRPTQGGQVSIALSS |
| Target: |
KL |
![]()
|
Sample Tissue: Human DLD1 Whole Cell, Antibody dilution: 1 ug/ml. |
![]()
|
Sample Tissue: Human OVCAR-3 Whole Cell, Antibody dilution: 1 ug/ml. |
![]()
|
Positive control (+): Human lung (LU), Negative control (-): Human brain (BR), Antibody concentration: 1 ug/ml. |
![]()
|
Immunohistochemistry with Kidney tissue at an antibody concentration of 5 ug/ml using anti-KL antibody (orb333709). |
![]()
|
WB Suggested Anti-KL Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: NCI-H226 cell lysate. |
