THRA Rabbit Polyclonal Antibody, Unconjugated

Catalog Number: BYT-ORB333849
Article Name: THRA Rabbit Polyclonal Antibody, Unconjugated
Biozol Catalog Number: BYT-ORB333849
Supplier Catalog Number: orb333849
Alternative Catalog Number: BYT-ORB333849-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human THRA
Conjugation: Unconjugated
Alternative Names: anti AR7 antibody, anti c-erbA-1 antibody, anti C-erbA-alpha antibody, anti EAR 7 antibody, anti EAR-7 antibody, anti EAR7 antibody, anti ERB-T-1 antibody, anti ERBA alpha antibody, anti ERBA antibody, anti ERBA Related 7 antibody, anti ERBA-related 7 antibody, anti ERBA1 antibody, anti NR1A1 antibody, anti Nuclear receptor subfamily 1 group A member 1 antibody, anti THRA 1 antibody, anti THRA antibody, anti THRA1 antibody, anti THRA2 antibody, anti Thyroid hormone receptor alpha antibody, anti thyroid hormone receptor, alpha (erythroblastic leukemia viral (v-erb-a) oncogene homolog, avian) antibody, anti thyroid normone nuclear receptor alpha variant 1 antibody, anti triiodothyronine receptor antibody, anti V-erbA-related protein 7 antibody
Rabbit polyclonal antibody to THRA
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 55kDa
NCBI: 003241
UniProt: P10827
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: DQIILLKGCCMEIMSLRAAVRYDPESDTLTLSGEMAVKREQLKNGGLGVV
Target: THRA
Sample Tissue: Mouse Heart, Antibody dilution: 1 ug/ml.
Sample Tissue: Mouse Spleen, Antibody dilution: 1 ug/ml.
Positive control (+): Human Ovary (OV), Negative control (-): Human stomach (ST), Antibody concentration: 0.5 ug/ml.
WB Suggested Anti-THRA Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Jurkat cell lysate, There is BioGPS gene expression data showing that THRA is expressed in Jurkat.
WB Suggested Anti-THRA antibody Titration: 1 ug/ml, Sample Type: Human heart.