Human DSG3 protein

Catalog Number: BYT-ORB358085
Article Name: Human DSG3 protein
Biozol Catalog Number: BYT-ORB358085
Supplier Catalog Number: orb358085
Alternative Catalog Number: BYT-ORB358085-20,BYT-ORB358085-100,BYT-ORB358085-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: 130KDA pemphigus vulgaris antigen , PVACadherin family member 6
This Human DSG3 protein spans the amino acid sequence from region 70-615aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 76.6 kDa
UniProt: P32926
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: IAKITSDYQATQKITYRISGVGIDQPPFGIFVVDKNTGDINITAIVDREETPSFLITCRALNAQGLDVEKPLILTVKILDINDNPPVFSQQIFMGEIEENSASNSLVMILNATDADEPNHLNSKIAFKIVSQEPAGTPMFLLSRNTGEVRTLTNSLDREQASSYRLVVSGADKDGEGLSTQCECNIKVKDVNDNFPMFRDSQYSARIEENILSSELLRFQVTDLDEEYTDNWLAVYFFTSGNEGNWFEIQTDPRT
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: Partial of His-SUMO-tag and expression region is 70-615aa
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.