Human FDXR protein

Catalog Number: BYT-ORB358091
Article Name: Human FDXR protein
Biozol Catalog Number: BYT-ORB358091
Supplier Catalog Number: orb358091
Alternative Catalog Number: BYT-ORB358091-20,BYT-ORB358091-100,BYT-ORB358091-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Ferredoxin--NADP(+) reductase , Ferredoxin reductase
This Human FDXR protein spans the amino acid sequence from region 33-451aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 61.6 kDa
UniProt: P22570
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: STQEKTPQICVVGSGPAGFYTAQHLLKQHPQAHVDIYEKQPVPFGLVRFGVAPDHPEVKSYGAEDHRALEIPGEELPGVCSARAFVGWYNGLPENQELEPDLSCDTAVILGQGNVALDVARILLTPPEHLERTDITKAALGVLRQSRVKTVWLVGRRGPLQVAFTIKELREMIQLPGARPILDPVDFLGLQDKIKEVPRPRKRLTELLLRTATEKPGPAEAARQASASRAWGLRFFRSPQQVLPSPDGRRAAGVR
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: Full length of Isoform 6 of His-SUMO-tag and expression region is 33-451aa
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) FDXR.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) FDXR.