Bovine INHA protein

Catalog Number: BYT-ORB358098
Article Name: Bovine INHA protein
Biozol Catalog Number: BYT-ORB358098
Supplier Catalog Number: orb358098
Alternative Catalog Number: BYT-ORB358098-20,BYT-ORB358098-100,BYT-ORB358098-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: INHA, Inhibin alpha chain
This Bovine INHA protein spans the amino acid sequence from region 227-360aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 30.6 kDa
UniProt: P07994
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Bos taurus (Bovine)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: STPPLPWPWSPAALRLLQRPPEEPAAHADCHRAALNISFQELGWDRWIVHPPSFIFYYCHGGCGLSPPQDLPLPVPGVPPTPVQPLSLVPGAQPCCAALPGTMRPLHVRTTSDGGYSFKYEMVPNLLTQHCACI
Application Notes: Biological Origin: Bos taurus (Bovine). Application Notes: Full length of Inhibin alpha chain of His-SUMO-tag and expression region is 227-360aa
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.