Rat KRT17 protein

Catalog Number: BYT-ORB358100
Article Name: Rat KRT17 protein
Biozol Catalog Number: BYT-ORB358100
Supplier Catalog Number: orb358100
Alternative Catalog Number: BYT-ORB358100-20,BYT-ORB358100-100,BYT-ORB358100-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Cytokeratin-17 , CK-17Keratin-17 , K17
This Rat KRT17 protein spans the amino acid sequence from region 1-441aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 64.7 kDa
UniProt: A1L595
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Bos taurus (Bovine)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MTTTIRHFSSGSIKGSSGLAGGSSRSCRVSGSLGGGSCRLGSAGGLGSGLGGSSYSSCYSFGSGGGYGSGGYVSGGYGGGFGGVDGLLVGGEKATMQNLNDRLASYLDKVRALEEANTELELKIRDWYQKQAPGPAPDYSSYFKTIEDLRNKIHTATVDNANLLLQIDNARLAADDFRTKFETEQALRVSVEADINGLRRVLDELTLARADLEMQIENLKEELAYLRKNHEEEMKALRGQVGGEINVEMDAAPGV
Application Notes: Biological Origin: Bos taurus (Bovine). Application Notes: Full length of His-SUMO-tag and expression region is 1-441aa
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.