Mouse Loxl1 protein
Catalog Number:
BYT-ORB358102
- Images (3)
| Article Name: | Mouse Loxl1 protein |
| Biozol Catalog Number: | BYT-ORB358102 |
| Supplier Catalog Number: | orb358102 |
| Alternative Catalog Number: | BYT-ORB358102-20,BYT-ORB358102-100,BYT-ORB358102-1 |
| Manufacturer: | Biorbyt |
| Category: | Proteine/Peptide |
| Alternative Names: | Lysyl oxidase 2Lysyl oxidase-like protein 1 |
| This Mouse Loxl1 protein spans the amino acid sequence from region 95-607aa. Purity: Greater than 90% as determined by SDS-PAGE. |
| Molecular Weight: | 60.5 kDa |
| UniProt: | P97873 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Mus musculus (Mouse) |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | RQAPSLPLPGRVGSDTVRGQTRHPFGFGQVPDNWREVAVGDSTGMARARTSVSQQRHGGSASSSVSASAFATTYRQPSPYPQQFPYPQAPFVNQYENYDPASRTYEQGYVYYRGAGGGMGAGAAAVASAGVIYPFQPRARYEDYGGGGGEEQPEYPAQGFYPAPERPYVPQPQPQPQPQPQPQPQPSDGLDRRYSHSLYNEGTPGFEQAYPDPSTDVSQAPAGAGGTYGGAGDPRLGWYPPYAANVPPEAYVPPR |
| Application Notes: | Biological Origin: Mus musculus (Mouse). Application Notes: Full length of His-tag and expression region is 95-607aa |



