Mouse Loxl1 protein

Catalog Number: BYT-ORB358102
Article Name: Mouse Loxl1 protein
Biozol Catalog Number: BYT-ORB358102
Supplier Catalog Number: orb358102
Alternative Catalog Number: BYT-ORB358102-20,BYT-ORB358102-100,BYT-ORB358102-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Lysyl oxidase 2Lysyl oxidase-like protein 1
This Mouse Loxl1 protein spans the amino acid sequence from region 95-607aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 60.5 kDa
UniProt: P97873
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Mus musculus (Mouse)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: RQAPSLPLPGRVGSDTVRGQTRHPFGFGQVPDNWREVAVGDSTGMARARTSVSQQRHGGSASSSVSASAFATTYRQPSPYPQQFPYPQAPFVNQYENYDPASRTYEQGYVYYRGAGGGMGAGAAAVASAGVIYPFQPRARYEDYGGGGGEEQPEYPAQGFYPAPERPYVPQPQPQPQPQPQPQPQPSDGLDRRYSHSLYNEGTPGFEQAYPDPSTDVSQAPAGAGGTYGGAGDPRLGWYPPYAANVPPEAYVPPR
Application Notes: Biological Origin: Mus musculus (Mouse). Application Notes: Full length of His-tag and expression region is 95-607aa
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Loxl1.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Loxl1.