Human PI3 protein

Catalog Number: BYT-ORB358114
Article Name: Human PI3 protein
Biozol Catalog Number: BYT-ORB358114
Supplier Catalog Number: orb358114
Alternative Catalog Number: BYT-ORB358114-20,BYT-ORB358114-100,BYT-ORB358114-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Elastase-specific inhibitor , ESIPeptidase inhibitor 3 , PI-3, Protease inhibitor WAP3Skin-derived antileukoproteinase , SKALPWAP four-disulfide core domain protein 14
This Human PI3 protein spans the amino acid sequence from region 61-117aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 22 kDa
UniProt: P19957
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: AQEPVKGPVSTKPGSCPIILIRCAMLNPPNRCLKDTDCPGIKKCCEGSCGMACFVPQ
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: Full length of His-SUMO-tag and expression region is 61-117aa
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.