Human RBKS protein

Catalog Number: BYT-ORB358115
Article Name: Human RBKS protein
Biozol Catalog Number: BYT-ORB358115
Supplier Catalog Number: orb358115
Alternative Catalog Number: BYT-ORB358115-20,BYT-ORB358115-100,BYT-ORB358115-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: RBKS, RBSK, Ribokinase, RK, EC 2.7.1.15
This Human RBKS protein spans the amino acid sequence from region 2-322aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 50 kDa
UniProt: Q9H477
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: AASGEPQRQWQEEVAAVVVVGSCMTDLVSLTSRLPKTGETIHGHKFFIGFGGKGANQCVQAARLGAMTSMVCKVGKDSFGNDYIENLKQNDISTEFTYQTKDAATGTASIIVNNEGQNIIVIVAGANLLLNTEDLRAAANVISRAKVMVCQLEITPATSLEALTMARRSGVKTLFNPAPAIADLDPQFYTLSDVFCCNESEAEILTGLTVGSAADAGEAALVLLKRGCQVVIITLGAEGCVVLSQTEPEPKHIPT
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: Full length of His-SUMO-tag and expression region is 2-322aa
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.