Rat Rgn protein

Catalog Number: BYT-ORB358116
Article Name: Rat Rgn protein
Biozol Catalog Number: BYT-ORB358116
Supplier Catalog Number: orb358116
Alternative Catalog Number: BYT-ORB358116-20,BYT-ORB358116-100,BYT-ORB358116-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Gluconolactonase (EC, 3.1.1.17) Short name, GNL Senescence marker protein 30 Short name, SMP-30 Smp30
This Rat Rgn protein spans the amino acid sequence from region 1-299aa. Purity: Greater than 85% as determined by SDS-PAGE.
Molecular Weight: 51.9 kDa
UniProt: Q03336
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Rattus norvegicus (Rat)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MSSIKIECVLRENYRCGESPVWEEASKCLLFVDIPSKTVCRWDSISNRVQRVGVDAPVSSVALRQSGGYVATIGTKFCALNWEDQSVFILAMVDEDKKNNRFNDGKVDPAGRYFAGTMAEETAPAVLERHQGSLYSLFPDHSVKKYFDQVDISNGLDWSLDHKIFYYIDSLSYTVDAFDYDLPTGQISNRRTVYKMEKDEQIPDGMCIDVEGKLWVACYNGGRVIRLDPETGKRLQTVKLPVDKTTSCCFGGKDY
Application Notes: Biological Origin: Rattus norvegicus (Rat). Application Notes: Full length of His-SUMO-tag and expression region is 1-299aa
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.