Human RGS7 protein

Catalog Number: BYT-ORB358117
Article Name: Human RGS7 protein
Biozol Catalog Number: BYT-ORB358117
Supplier Catalog Number: orb358117
Alternative Catalog Number: BYT-ORB358117-20,BYT-ORB358117-100,BYT-ORB358117-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: RGS7, Regulator of G-protein signaling 7, RGS7
This Human RGS7 protein spans the amino acid sequence from region 1-487aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 60.7 kDa
UniProt: P49802
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MAQGNNYGQTSNGVADESPNMLVYRKMEDVIARMQDEKNGIPIRTVKSFLSKIPSVFSGSDIVQWLIKNLTIEDPVEALHLGTLMAAHGYFFPISDHVLTLKDDGTFYRFQTPYFWPSNCWEPENTDYAVYLCKRTMQNKARLELADYEAESLARLQRAFARKWEFIFMQAEAQAKVDKKRDKIERKILDSQERAFWDVHRPVPGCVNTTEVDIKKSSRMRNPHKTRKSVYGLQNDIRSHSPTHTPTPETKPPTE
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: Full length of isofrm5 of His-tag and expression region is 1-487aa
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.