Rat alpha 1 Antitrypsin protein

Catalog Number: BYT-ORB358120
Article Name: Rat alpha 1 Antitrypsin protein
Biozol Catalog Number: BYT-ORB358120
Supplier Catalog Number: orb358120
Alternative Catalog Number: BYT-ORB358120-20,BYT-ORB358120-100,BYT-ORB358120-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: A1A protein, A1AT protein, AAT protein, Alpha 1 antitrypsin protein, Alpha1AT protein, Dom1 protein, PI1 protein, PRO2275 protein, Serpin A1 protein, Serpin A1a protein, Serpina1 protein, Short peptide from AAT protein, SPAAT protein, Spi1-1 protein
This Rat alpha 1 Antitrypsin protein spans the amino acid sequence from region 25-411aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 59.7 kDa
UniProt: P17475
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Rattus norvegicus (Rat)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: EDAQETDTSQQDQSPTYRKISSNLADFAFSLYRELVHQSNTSNIFFSPMSITTAFAMLSLGSKGDTRKQILEGLEFNLTQIPEADIHKAFHHLLQTLNRPDSELQLNTGNGLFVNKNLKLVEKFLEEVKNNYHSEAFSVNFADSEEAKKVINDYVEKGTQGKIVDLMKQLDEDTVFALVNYIFFKGKWKRPFNPEHTRDADFHVDKSTTVKVPMMNRLGMFDMHYCSTLSSWVLMMDYLGNATAIFLLPDDGKMQ
Application Notes: Biological Origin: Rattus norvegicus (Rat). Application Notes: Full length of His-SUMO-tag and expression region is 25-411aa
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.