Human SSB protein

Catalog Number: BYT-ORB358125
Article Name: Human SSB protein
Biozol Catalog Number: BYT-ORB358125
Supplier Catalog Number: orb358125
Alternative Catalog Number: BYT-ORB358125-20,BYT-ORB358125-100,BYT-ORB358125-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: La autoantigen, La ribonucleoprotein, Sjoegren syndrome type B antigen , SS-B
This Human SSB protein spans the amino acid sequence from region 1-408aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 62.8 kDa
UniProt: P05455
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MAENGDNEKMAALEAKICHQIEYYFGDFNLPRDKFLKEQIKLDEGWVPLEIMIKFNRLNRLTTDFNVIVEALSKSKAELMEISEDKTKIRRSPSKPLPEVTDEYKNDVKNRSVYIKGFPTDATLDDIKEWLEDKGQVLNIQMRRTLHKAFKGSIFVVFDSIESAKKFVETPGQKYKETDLLILFKDDYFAKKNEERKQNKVEAKLRAKQEQEAKQKLEEDAEMKSLEEKIGCLLKFSGDLDDQTCREDLHILFSN
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: Full length of His-SUMO-tag and expression region is 1-408aa
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.