Bacterial ompA protein

Catalog Number: BYT-ORB358135
Article Name: Bacterial ompA protein
Biozol Catalog Number: BYT-ORB358135
Supplier Catalog Number: orb358135
Alternative Catalog Number: BYT-ORB358135-20,BYT-ORB358135-100,BYT-ORB358135-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: /
This Bacterial ompA protein spans the amino acid sequence from region 24-374aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 54.1 kDa
UniProt: T2DH55
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Chlamydia pecorum
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: LPVGNPAEPSLLIDGTIWEGMSGDPCDPCATWCDAISLRVGFYGDYVFDRVLKTDVPQKFSMGQAPSTNSPADSVSLQERENPAYGKHMHDAEWFTNAGYIALNIWDRFDVFCTLGATSGYFKGNSSSFNLIGLIGISGSDLNSKVPNASISNGVVELYTDTTFSWSVGARGALWECGCATLGAEFQYAQSKPRVQELNVLSNVAQFTVHRPKGYVNQTLPLPITAGTATDSNEKLKNATINYHEWQVGAALSYR
Application Notes: Biological Origin: Chlamydia pecorum. Application Notes: Full length of His-SUMO-tag and expression region is 24-374aa
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.