Plant Ribosome-inactivating protein lychnin protein

Catalog Number: BYT-ORB358136
Article Name: Plant Ribosome-inactivating protein lychnin protein
Biozol Catalog Number: BYT-ORB358136
Supplier Catalog Number: orb358136
Alternative Catalog Number: BYT-ORB358136-20,BYT-ORB358136-100,BYT-ORB358136-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Ribosome-inactivating protein lychnin, EC 3.2.2.22
This Plant Ribosome-inactivating protein lychnin protein spans the amino acid sequence from region 1-234aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 30.1 kDa
UniProt: P85101
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Silene chalcedonica (Maltese-cross) (Lychnis chalcedonica)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: RPSWTVDSDSAKYSSFLDSLREEFGRGTPKVCNIPVTKKANNDKFVLVNLVLPFNRNTITLAFRASDAYLVGFQDRDSKTNKLRANFFSDEYRALSGKYKSIFTDAEVLAPALPCASTYTDLQNKAGVSREKLSLGVSSLQTAFTAVYGKVFTGKNVAKFALISIQMVAEAARFKYIEDQVINRGMYSSFEAGARITLLENNWSKISEQYHKSCKLGGGQFTEEEMKLGLLLYN
Application Notes: Biological Origin: Silene chalcedonica (Maltese-cross) (Lychnis chalcedonica). Application Notes: Full length of His-tag and expression region is 1-234aa
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.