Rat Dac g 3 protein

Catalog Number: BYT-ORB358138
Article Name: Rat Dac g 3 protein
Biozol Catalog Number: BYT-ORB358138
Supplier Catalog Number: orb358138
Alternative Catalog Number: BYT-ORB358138-20,BYT-ORB358138-100,BYT-ORB358138-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Pollen allergen Dac g 3, Allergen Dac g III, allergen Dac g 3, Fragment
This Rat Dac g 3 protein spans the amino acid sequence from region 1-96aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 26.9 kDa
UniProt: P93124
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Dactylis glomerata (Orchard grass) (Cocks-foot grass)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: VKVTFKVEKGSDPKKLVLDIKYTRPGDTLAEVELRQHGSEEWEPLTKKGNLWEVKSSKPLTGPFNFRFMSKGGMRNVFDEVIPTAFKIGTTYTPEE
Application Notes: Biological Origin: Dactylis glomerata (Orchard grass) (Cocks-foot grass). Application Notes: Full length of His-SUMO-tag and expression region is 1-96aa
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.