Viral vpx protein

Catalog Number: BYT-ORB358144
Article Name: Viral vpx protein
Biozol Catalog Number: BYT-ORB358144
Supplier Catalog Number: orb358144
Alternative Catalog Number: BYT-ORB358144-20,BYT-ORB358144-100,BYT-ORB358144-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Viral protein XX ORF protein
This Viral vpx protein spans the amino acid sequence from region 1-112aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 29.2 kDa
UniProt: P11266
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Simian immunodeficiency virus (isolate K78) (SIV-mac) (Simian immunodeficiency virus rhesus monkey)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MSDPRERIPPRNSGEETIGEAFEWLNRTVEEINREAVNHLPRELIFQVWQRSWEYWHDEQRMSQSYVKYRYLCLMQKALFMHCKKGCRCLGEGHRAGGWRPGPPPPPPPGLA
Application Notes: Biological Origin: Simian immunodeficiency virus (isolate K78) (SIV-mac) (Simian immunodeficiency virus rhesus monkey). Application Notes: Full length of His-SUMO-tag and expression region is 1-112aa
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.