Animal OP-3 protein
Catalog Number:
BYT-ORB358148
- Images (3)
| Article Name: | Animal OP-3 protein |
| Biozol Catalog Number: | BYT-ORB358148 |
| Supplier Catalog Number: | orb358148 |
| Alternative Catalog Number: | BYT-ORB358148-20,BYT-ORB358148-100,BYT-ORB358148-1 |
| Manufacturer: | Biorbyt |
| Category: | Proteine/Peptide |
| Alternative Names: | Antifreeze protein lambda OP-3 |
| This Animal OP-3 protein spans the amino acid sequence from region 23-91aa. Purity: Greater than 90% as determined by SDS-PAGE. |
| Molecular Weight: | 11.6 kDa |
| UniProt: | P19606 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Zoarces americanus (Ocean pout) (Macrozoarces americanus) |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | NQSVVATQLIPINTALTLVMMTTRVIYPTGIPAEDIPRLVSMQVNQAVPMGTTLMPDMVKFYCLCAPKN |
| Application Notes: | Biological Origin: Zoarces americanus (Ocean pout) (Macrozoarces americanus). Application Notes: Full length of His-tag and expression region is 23-91aa |



